- Search results for GeneID 23492
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "GeneID 23492"!
Close filters
Filter by:
No results were found for the filter!
Item number: A302-525A
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...
Keywords: | Anti-CBX7, Anti-Chromobox protein homolog 7 |
Application: | WB, IP, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 164.00€
*
Item number: BPS-55017
Human chromobox homolog 7 (CBX7), GenBank Accession No. NM_175709, a.a. 2-90, with N-terminal His-tag, MW=11.6 kDa, expressed in an E. coli cell expression system.
Keywords: | CBX7, Chromobox protein homolog 7, |
Application: | Binding assays, screening inhibitors, selectivity profiling |
Expressed in: | E.coli |
Origin: | human |
MW: | 11.6 kD |
679.00€
*
Item number: IHC-00696
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...
Keywords: | Anti-CBX7, Anti-Chromobox protein homolog 7 |
Application: | IHC |
Host: | Rabbit |
Species reactivity: | human |
From 164.00€
*
Item number: E-AB-17698.120
CBX7 (Chromobox protein homolog 7) is a 251 amino acid nuclear protein that contains one N-terminal chromo domain and one C-terminal Pc box. Highly expressed in kidney, brain, heart and skeletal muscle, with weaker expression in peripheral blood leukocytes, CBX7 functions as a component of the chromatin-associated...
Keywords: | Anti-CBX7, Anti-Chromobox protein homolog 7, CBX7 Polyclonal Antibody |
Application: | WB, IHC, ELISA |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 71.00€
*
Item number: NSJ-RQ4819
Antibody in PBS with 0.02% sodium azide, 50% glycerol and 0.4-0.5mg/ml BSA. Control of cell proliferation by Polycomb group proteins (PcG) is an important facet of cellular homeostasis and its disruption can promote tumorigenesis. 'Chromobox protein homolog 7' is a PcG protein which is found to control the growth of...
Keywords: | Anti-CBX7, Anti-Chromobox protein homolog 7, CBX7 Antibody |
Application: | WB |
Host: | Rabbit |
Species reactivity: | human |
755.00€
*
Item number: ATA-HPA048677.100
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...
Keywords: | Anti-CBX7, Anti-Chromobox protein homolog 7 |
Application: | IHC |
Host: | Rabbit |
Species reactivity: | human |
From 335.00€
*
Item number: ATA-HPA056480.100
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...
Keywords: | Anti-CBX7, Anti-Chromobox protein homolog 7 |
Application: | ICC, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 335.00€
*
Item number: 298388.100
Source:, Recombinant protein corresponding to aa2-90 from human CBX7, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.6kD, AA Sequence: MHHHHHHELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDP, RLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLR, Applications: Suitable for use in protein binding...
Keywords: | CBX7, Chromobox protein homolog 7 |
MW: | 11,6 |
1,151.00€
*
Item number: 372609.100
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of...
Keywords: | CBX7, Chromobox protein homolog 7 |
MW: | 32,3 |
From 511.00€
*
Item number: ATA-APrEST87513.100
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...
Keywords: | CBX7, Chromobox protein homolog 7 |
Application: | Control antigen |
Expressed in: | E.coli |
Origin: | human |
247.00€
*
Item number: ATA-APrEST87759.100
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...
Keywords: | CBX7, Chromobox protein homolog 7 |
Application: | Control antigen |
Expressed in: | E.coli |
Origin: | human |
247.00€
*
Item number: 372610.100
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of...
Keywords: | CBX7, Chromobox protein homolog 7 |
MW: | 30,3 |
From 531.00€
*